PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g46212.1.p
Common NameBRADI_1g46212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 645aa    MW: 71301.1 Da    PI: 8.56
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g46212.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR137.39.2e-121221624990
              FAR1  49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        ++rr+++ ++tgCkak++vk+  dg+wev+ +++eHnHel 
  Bradi1g46212.1.p 122 GEKRRRESIKQTGCKAKMTVKLI-DGRWEVIFFVTEHNHELI 162
                       57899999***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.8E-9122162IPR004330FAR1 DNA binding domain
PROSITE profilePS509669.112368404IPR007527Zinc finger, SWIM-type
PfamPF044342.6E-5374403IPR007527Zinc finger, SWIM-type
SMARTSM005750.0043379406IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MLDLNEISCD LDDGFGECVE PSYCTPAILV AVHEEVGESP VTIRIAENEP LVGAPIAGDS  60
TAVADDTNVV AEDTTGVACD APDNIEQEIE CSSQPQEPFL GMRFDTLAGA KVHYNAYPRE  120
GGEKRRRESI KQTGCKAKMT VKLIDGRWEV IFFVTEHNHE LITKPSLIKY LLSHKNISPE  180
EEAFLRILDD CNLETGQMMA LMSTFYANGF IVPYTTKTIS NFRSKIRSER KGDDMAETVS  240
YFMAKQKEAP SFYFNVKLDE DERDMGACYF RDCFFPFLQS TQRSEGFNAV LKRYVNPHNS  300
ILNFVKQYEK IQVKILKQAF ATYTRDIYVK FRDEFMLTGR YNVRPQQNDL YRLEPNMTYC  360
QFYGSRSYLV LTRVGNEEYS CECGKMKRDG LLCCHILKVF THIGIDEIPG RYIMRRWTQN  420
AVPREQIRMA NLSVKYGELA RIGCCSDAAN AIAEKYIRVT KTEINHLNLT RRKDAKRRRE  480
TTARKASARS ASSAPVTTQA TTAPAPATAP RPAATSGGAP ATTTPTPATA TASMVSGAVT  540
VPAPATATRR AATFGCAPAT ASRRPATTTA GPAIAAASAA SGAATASASI NPNCVRNPDR  600
CPTKGRPRVK RYETALELHP KKKNKCALCS SDEHNSARCP RKLA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3K3R10.0A0A0Q3K3R1_BRADI; Uncharacterized protein
STRINGBRADI1G46210.11e-152(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7287518
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-14FAR1-related sequence 5